Lineage for d1cc0c_ (1cc0 C:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 313180Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 313181Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (21 families) (S)
    division into families based on beta-sheet topologies
  5. 313510Family c.37.1.8: G proteins [52592] (35 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 313810Protein RhoA [52612] (1 species)
  7. 313811Species Human (Homo sapiens) [TaxId:9606] [52613] (9 PDB entries)
  8. 313824Domain d1cc0c_: 1cc0 C: [32051]
    Other proteins in same PDB: d1cc0e_, d1cc0f_

Details for d1cc0c_

PDB Entry: 1cc0 (more details), 5 Å

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex

SCOP Domain Sequences for d1cc0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc0c_ c.37.1.8 (C:) RhoA {Human (Homo sapiens)}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr
gkkksgc

SCOP Domain Coordinates for d1cc0c_:

Click to download the PDB-style file with coordinates for d1cc0c_.
(The format of our PDB-style files is described here.)

Timeline for d1cc0c_: