Lineage for d1cc0c_ (1cc0 C:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179429Family c.37.1.8: G proteins [52592] (26 proteins)
  6. 179673Protein RhoA [52612] (1 species)
  7. 179674Species Human (Homo sapiens) [TaxId:9606] [52613] (7 PDB entries)
  8. 179685Domain d1cc0c_: 1cc0 C: [32051]
    Other proteins in same PDB: d1cc0e_, d1cc0f_

Details for d1cc0c_

PDB Entry: 1cc0 (more details), 5 Å

PDB Description: crystal structure of the rhoa.gdp-rhogdi complex

SCOP Domain Sequences for d1cc0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc0c_ c.37.1.8 (C:) RhoA {Human (Homo sapiens)}
irkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqarr
gkkksgc

SCOP Domain Coordinates for d1cc0c_:

Click to download the PDB-style file with coordinates for d1cc0c_.
(The format of our PDB-style files is described here.)

Timeline for d1cc0c_: