Lineage for d1a2b__ (1a2b -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23308Protein RhoA [52612] (1 species)
  7. 23309Species Human (Homo sapiens) [TaxId:9606] [52613] (6 PDB entries)
  8. 23314Domain d1a2b__: 1a2b - [32049]

Details for d1a2b__

PDB Entry: 1a2b (more details), 2.4 Å

PDB Description: human rhoa complexed with gtp analogue

SCOP Domain Sequences for d1a2b__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2b__ c.37.1.8 (-) RhoA {Human (Homo sapiens)}
irkklvivgdvacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtagq
edydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrn
dehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa

SCOP Domain Coordinates for d1a2b__:

Click to download the PDB-style file with coordinates for d1a2b__.
(The format of our PDB-style files is described here.)

Timeline for d1a2b__: