SCOPe 2.08: Domain d5kwra1: 5kwr A:57-193

Lineage for d5kwra1 (5kwr A:57-193)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.0: automated matches [191519] (1 protein)
   not a true family

6. Protein automated matches [190873] (4 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [320477] (4 PDB entries)

8. Domain d5kwra1: 5kwr A:57-193 [320478]
   Other proteins in same PDB: d5kwra2
   automated match to d2wnvb_

Details for d5kwra1

PDB Entry: 5kwr, 1.8 Å

PDB Description: crystal structure of rat cerebellin-1

PDB Compounds: (A:) Cerebellin-1

SCOPe Domain Sequences for d5kwra1:

Sequence; same for both SEQRES and ATOM records:

>d5kwra1 b.22.1.0 (A:57-193) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sgsakvafsairstnhepsemsnrtmiiyfdqvlvnignnfdserstfiaprkgiysfnf
hvvkvynrqtiqvslmlngwpvisafagdqdvtreaasngvliqmekgdraylklergnl
mggwkystfsgflvfpl

Timeline for d5kwra1:

• d5kwra1 first appeared in SCOPe 2.06
  
• d5kwra1 appears in SCOPe 2.07