Lineage for d5kmya1 (5kmy A:2-269)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413784Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2414536Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2414537Protein automated matches [190292] (35 species)
    not a true protein
  7. 2414650Species Legionella pneumophila [TaxId:297246] [320463] (1 PDB entry)
  8. 2414651Domain d5kmya1: 5kmy A:2-269 [320464]
    Other proteins in same PDB: d5kmya2
    automated match to d4ht3a_

Details for d5kmya1

PDB Entry: 5kmy (more details), 1.91 Å

PDB Description: crystal structure of tryptophan synthase subunit alpha from legionella pneumophila str. paris
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d5kmya1:

Sequence, based on SEQRES records: (download)

>d5kmya1 c.1.2.0 (A:2-269) automated matches {Legionella pneumophila [TaxId: 297246]}
mnridktleklkanrkkmlspyitagdpypeltvslmhqlvksgadvlelgipfsdpmae
gpviqrameralahsihcddvlnmvrqfrktdtetpvilmgylnpieqygydlfaqqave
agadgtilvdlppeeadgvsrvwqkhglysiylcspttsaermnfinqhangylyyvslk
gvtgsdalklpelkaqylqrkaqsklplmvgfgiktpemaaqvaefadgvivgaalinei
ieayeakkdplqasgallssmrqaidni

Sequence, based on observed residues (ATOM records): (download)

>d5kmya1 c.1.2.0 (A:2-269) automated matches {Legionella pneumophila [TaxId: 297246]}
mnridktleklkanrkkmlspyitagdpypeltvslmhqlvksgadvlelgipfsdpmae
gpviqrameralahsihcddvlnmvrqfrktdtetpvilmgylnpieqygydlfaqqave
agadgtilvdlppeeadgvsrvwqkhglysiylcspttsaermnfinqhangylyyvsla
lklpelkaqylqrkaqsklplmvgfgiktpemaaqvaefadgvivgaalineiieayeak
kdplqasgallssmrqaidni

SCOPe Domain Coordinates for d5kmya1:

Click to download the PDB-style file with coordinates for d5kmya1.
(The format of our PDB-style files is described here.)

Timeline for d5kmya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kmya2