Lineage for d1dpfa_ (1dpf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867786Protein RhoA [52612] (1 species)
  7. 2867787Species Human (Homo sapiens) [TaxId:9606] [52613] (39 PDB entries)
    Uniprot P61586 2-181
  8. 2867812Domain d1dpfa_: 1dpf A: [32046]
    complexed with gdp

Details for d1dpfa_

PDB Entry: 1dpf (more details), 2 Å

PDB Description: crystal structure of a mg-free form of rhoa complexed with gdp
PDB Compounds: (A:) rhoa

SCOPe Domain Sequences for d1dpfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dpfa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}
airkklvivgdvacgktcllivfskdqfpavyvptvfenyvadievdgkqvelalwdtag
qedydrarplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtarelakmkqepvkpaegrdmanrigafgymecsaktkdgvrevfematraalq

SCOPe Domain Coordinates for d1dpfa_:

Click to download the PDB-style file with coordinates for d1dpfa_.
(The format of our PDB-style files is described here.)

Timeline for d1dpfa_: