Lineage for d1tx4b_ (1tx4 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23308Protein RhoA [52612] (1 species)
  7. 23309Species Human (Homo sapiens) [TaxId:9606] [52613] (6 PDB entries)
  8. 23310Domain d1tx4b_: 1tx4 B: [32045]
    Other proteins in same PDB: d1tx4a_

Details for d1tx4b_

PDB Entry: 1tx4 (more details), 1.65 Å

PDB Description: rho/rhogap/gdp(dot)alf4 complex

SCOP Domain Sequences for d1tx4b_:

Sequence, based on SEQRES records: (download)

>d1tx4b_ c.37.1.8 (B:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivnskdqfpevyvptvfenyvadievdgaqvelalwdtag
qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal

Sequence, based on observed residues (ATOM records): (download)

>d1tx4b_ c.37.1.8 (B:) RhoA {Human (Homo sapiens)}
airkklvivgdgacgktcllivnskdqfyvptvfenyvadievdgkqvelalwdtagqed
ydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlrnde
htrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraal

SCOP Domain Coordinates for d1tx4b_:

Click to download the PDB-style file with coordinates for d1tx4b_.
(The format of our PDB-style files is described here.)

Timeline for d1tx4b_: