Lineage for d1qbkc_ (1qbk C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 987698Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 988331Protein Ran [52609] (2 species)
  7. 988348Species Human (Homo sapiens) [TaxId:9606] [52611] (8 PDB entries)
  8. 988366Domain d1qbkc_: 1qbk C: [32044]
    Other proteins in same PDB: d1qbkb_
    complexed with gnp, mg

Details for d1qbkc_

PDB Entry: 1qbk (more details), 3 Å

PDB Description: structure of the karyopherin beta2-ran gppnhp nuclear transport complex
PDB Compounds: (C:) ran

SCOPe Domain Sequences for d1qbkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbkc_ c.37.1.8 (C:) Ran {Human (Homo sapiens) [TaxId: 9606]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqy

SCOPe Domain Coordinates for d1qbkc_:

Click to download the PDB-style file with coordinates for d1qbkc_.
(The format of our PDB-style files is described here.)

Timeline for d1qbkc_: