Lineage for d1qbkc_ (1qbk C:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484126Family c.37.1.8: G proteins [52592] (43 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 484471Protein Ran [52609] (2 species)
  7. 484485Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)
  8. 484496Domain d1qbkc_: 1qbk C: [32044]
    Other proteins in same PDB: d1qbkb_

Details for d1qbkc_

PDB Entry: 1qbk (more details), 3 Å

PDB Description: structure of the karyopherin beta2-ran gppnhp nuclear transport complex

SCOP Domain Sequences for d1qbkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbkc_ c.37.1.8 (C:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqy

SCOP Domain Coordinates for d1qbkc_:

Click to download the PDB-style file with coordinates for d1qbkc_.
(The format of our PDB-style files is described here.)

Timeline for d1qbkc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qbkb_