Lineage for d1qbkc_ (1qbk C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Ran [52609] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [52611] (3 PDB entries) 
Domain d1qbkc_: 1qbk C: [32044]
Other proteins in same PDB: d1qbkb_
Details for d1qbkc_
PDB Entry: 1qbk (more details), 3 Å
PDB Description: structure of the karyopherin beta2-ran gppnhp nuclear transport complex
SCOP Domain Sequences for d1qbkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qbkc_ c.37.1.8 (C:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqy
SCOP Domain Coordinates for d1qbkc_:
Click to download the PDB-style file with coordinates for d1qbkc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qbkc_:
- d1qbkc_ appears in SCOP 1.57
- d1qbkc_ appears in the current release, SCOPe 2.08
View in 3D
