Lineage for d5b33f_ (5b33 F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698446Protein Histone H4 [47125] (7 species)
  7. 2698556Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries)
  8. 2698661Domain d5b33f_: 5b33 F: [320436]
    Other proteins in same PDB: d5b33a_, d5b33c_, d5b33d_, d5b33e_, d5b33g_, d5b33h_
    automated match to d1kx3f_
    protein/DNA complex

Details for d5b33f_

PDB Entry: 5b33 (more details), 2.93 Å

PDB Description: the crystal structure of the h2az nucleosome with h3.3.
PDB Compounds: (F:) histone h4

SCOPe Domain Sequences for d5b33f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b33f_ a.22.1.1 (F:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
ktvtamdvvyalkrqgrtlygfgg

SCOPe Domain Coordinates for d5b33f_:

Click to download the PDB-style file with coordinates for d5b33f_.
(The format of our PDB-style files is described here.)

Timeline for d5b33f_: