Lineage for d1rrpa_ (1rrp A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.8: G proteins [52592] (20 proteins) 
Protein Ran [52609] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [52611] (3 PDB entries) 
Domain d1rrpa_: 1rrp A: [32042]
Other proteins in same PDB: d1rrpb_, d1rrpd_
Details for d1rrpa_
PDB Entry: 1rrp (more details), 2.96 Å
PDB Description: structure of the ran-gppnhp-ranbd1 complex
SCOP Domain Sequences for d1rrpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrpa_ c.37.1.8 (A:) Ran {Human (Homo sapiens)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqttalpd
SCOP Domain Coordinates for d1rrpa_:
Click to download the PDB-style file with coordinates for d1rrpa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rrpa_:
- d1rrpa_ appears in SCOP 1.57
- d1rrpa_ appears in the current release, SCOPe 2.07
View in 3D
