Lineage for d5jv3d1 (5jv3 D:3-68)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2343400Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
    dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices
  4. 2343401Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family) (S)
  5. 2343402Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 protein domains)
    Pfam PF03271
  6. 2343403Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (3 species)
  7. 2343404Species Human (Homo sapiens) [TaxId:9606] [140615] (12 PDB entries)
    Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254
  8. 2343420Domain d5jv3d1: 5jv3 D:3-68 [320413]
    Other proteins in same PDB: d5jv3d2
    automated match to d3gjoa_
    complexed with ca

Details for d5jv3d1

PDB Entry: 5jv3 (more details), 2.01 Å

PDB Description: the neck-linker and alpha 7 helix of homo sapiens eg5 fused to eb1
PDB Compounds: (D:) Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d5jv3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jv3d1 a.245.1.1 (D:3-68) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
nqkltkkalikeyteeierlkrdlaalekerdfyfgklrnielicqenegendpvlqriv
dilyat

SCOPe Domain Coordinates for d5jv3d1:

Click to download the PDB-style file with coordinates for d5jv3d1.
(The format of our PDB-style files is described here.)

Timeline for d5jv3d1: