SCOP 1.67: Domain d1ibrc_: 1ibr C:

Lineage for d1ibrc_ (1ibr C:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (37 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)

8. Domain d1ibrc_: 1ibr C: [32041]
   Other proteins in same PDB: d1ibrb_, d1ibrd_
   complexed with gnp, mg

Details for d1ibrc_

PDB Entry: 1ibr, 2.3 Å

PDB Description: complex of ran with importin beta

SCOP Domain Sequences for d1ibrc_:

Sequence; same for both SEQRES and ATOM records:

>d1ibrc_ c.37.1.8 (C:) Ran {Human (Homo sapiens)}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv

Timeline for d1ibrc_:

• d1ibrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ibrc_ appears in SCOP 1.65
  
• d1ibrc_ appears in SCOP 1.69
  
• d1ibrc_ appears in the current release, SCOPe 2.08