SCOP 1.59: Domain d1ibrc_: 1ibr C:

Lineage for d1ibrc_ (1ibr C:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families)

5. Family c.37.1.8: G proteins [52592] (23 proteins)

6. Protein Ran [52609] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries)

8. Domain d1ibrc_: 1ibr C: [32041]
   Other proteins in same PDB: d1ibrb_, d1ibrd_

Details for d1ibrc_

PDB Entry: 1ibr, 2.3 Å

PDB Description: complex of ran with importin beta

SCOP Domain Sequences for d1ibrc_:

Sequence; same for both SEQRES and ATOM records:

>d1ibrc_ c.37.1.8 (C:) Ran {Human (Homo sapiens)}
vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv

Timeline for d1ibrc_:

• d1ibrc_ first appeared (with stable ids) in SCOP 1.55
  
• d1ibrc_ appears in SCOP 1.57
  
• d1ibrc_ appears in SCOP 1.61
  
• d1ibrc_ appears in the current release, SCOPe 2.08