Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) |
Family c.37.1.8: G proteins [52592] (23 proteins) |
Protein Ran [52609] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52611] (6 PDB entries) |
Domain d1ibrc_: 1ibr C: [32041] Other proteins in same PDB: d1ibrb_, d1ibrd_ |
PDB Entry: 1ibr (more details), 2.3 Å
SCOP Domain Sequences for d1ibrc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ibrc_ c.37.1.8 (C:) Ran {Human (Homo sapiens)} vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefv
Timeline for d1ibrc_: