| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
| Protein automated matches [191142] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries) |
| Domain d5g44a1: 5g44 A:265-507 [320405] Other proteins in same PDB: d5g44a2 automated match to d3l0la_ protein/DNA complex; complexed with dms, i6g, na, swx, ytz |
PDB Entry: 5g44 (more details), 1.84 Å
SCOPe Domain Sequences for d5g44a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g44a1 a.123.1.0 (A:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfs
Timeline for d5g44a1: