Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries) |
Domain d5g55a3: 5g55 A:525-725 [320399] Other proteins in same PDB: d5g55a1, d5g55a2, d5g55a4 automated match to d1e8ya1 complexed with 3qh, so4 |
PDB Entry: 5g55 (more details), 2.45 Å
SCOPe Domain Sequences for d5g55a3:
Sequence, based on SEQRES records: (download)
>d5g55a3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia qsrhyqqrfavileaylrgcg
>d5g55a3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]} hraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr gcg
Timeline for d5g55a3: