Lineage for d5g55a3 (5g55 A:525-725)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2338494Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2338495Superfamily a.118.1: ARM repeat [48371] (27 families) (S)
  5. 2339141Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2339142Protein automated matches [190220] (14 species)
    not a true protein
  7. 2339168Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. 2339216Domain d5g55a3: 5g55 A:525-725 [320399]
    Other proteins in same PDB: d5g55a1, d5g55a2, d5g55a4
    automated match to d1e8ya1
    complexed with 3qh, so4

Details for d5g55a3

PDB Entry: 5g55 (more details), 2.45 Å

PDB Description: 3-quinoline carboxamides inhibitors of pi3k
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d5g55a3:

Sequence, based on SEQRES records: (download)

>d5g55a3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hpialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
hpkaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d5g55a3 a.118.1.0 (A:525-725) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssvkwgqqe
ivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyllq
lvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileaylr
gcg

SCOPe Domain Coordinates for d5g55a3:

Click to download the PDB-style file with coordinates for d5g55a3.
(The format of our PDB-style files is described here.)

Timeline for d5g55a3: