![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) ![]() two constituent families are related by circular permutation |
![]() | Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
![]() | Protein automated matches [190497] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries) |
![]() | Domain d5g55a2: 5g55 A:355-524 [320398] Other proteins in same PDB: d5g55a1, d5g55a3, d5g55a4 automated match to d1he8a2 complexed with 3qh, so4 |
PDB Entry: 5g55 (more details), 2.45 Å
SCOPe Domain Sequences for d5g55a2:
Sequence, based on SEQRES records: (download)
>d5g55a2 b.7.1.0 (A:355-524) automated matches {Human (Homo sapiens) [TaxId: 9606]} wdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwl efsikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfl lrrgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldnyc
>d5g55a2 b.7.1.0 (A:355-524) automated matches {Human (Homo sapiens) [TaxId: 9606]} wdcdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwl efsikikdlpkgallnlqiycqllyyvnlllidhrfllrrgeyvlhmwqisgfnadklts atnpdkensmsisilldnyc
Timeline for d5g55a2: