SCOPe 2.06: Domain d5jv3a_: 5jv3 A:

Lineage for d5jv3a_ (5jv3 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.245: EB1 dimerisation domain-like [140611] (1 superfamily)
   dimeric 4-helical bundle with a coiled coil at one end formed by the longer N-terminal helices

4. Superfamily a.245.1: EB1 dimerisation domain-like [140612] (1 family)

5. Family a.245.1.1: EB1 dimerisation domain-like [140613] (2 proteins)
   Pfam PF03271

6. Protein Microtubule-associated protein EB1, C-terminal dimerization domain [140614] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140615] (10 PDB entries)
   Uniprot Q15691 189-249! Uniprot Q15691 189-254! Uniprot Q15691 190-248! Uniprot Q15691 191-254

8. Domain d5jv3a_: 5jv3 A: [320395]
   Other proteins in same PDB: d5jv3d2
   automated match to d3gjoa_
   complexed with ca

Details for d5jv3a_

PDB Entry: 5jv3, 2.01 Å

PDB Description: the neck-linker and alpha 7 helix of homo sapiens eg5 fused to eb1

PDB Compounds: (A:) Chimera protein of Kinesin-like protein KIF11 and Microtubule-associated protein RP/EB family member 1

SCOPe Domain Sequences for d5jv3a_:

Sequence, based on SEQRES records:

>d5jv3a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
kkalikeyteeierlkrdlaalekerdfyfgklrnielicqenegendpvlqrivdilya
tdegf

Sequence, based on observed residues (ATOM records):

>d5jv3a_ a.245.1.1 (A:) Microtubule-associated protein EB1, C-terminal dimerization domain {Human (Homo sapiens) [TaxId: 9606]}
kkalikeyteeierlkrdlaalekerdfyfgklrnielicqenedpvlqrivdilyatde
gf

Timeline for d5jv3a_:

• d5jv3a_ is new in SCOPe 2.06-stable
  
• d5jv3a_ appears in SCOPe 2.07
  
• d5jv3a_ appears in the current release, SCOPe 2.08