Lineage for d5dvxb_ (5dvx B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2401367Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2401368Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2402282Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2402283Protein automated matches [191011] (14 species)
    not a true protein
  7. 2402364Species Human (Homo sapiens) [TaxId:9606] [188766] (17 PDB entries)
  8. 2402370Domain d5dvxb_: 5dvx B: [320393]
    automated match to d3iaib_
    complexed with cl, gol, trs, zn

Details for d5dvxb_

PDB Entry: 5dvx (more details), 1.6 Å

PDB Description: crystal structure of the catalytic-domain of human carbonic anhydrase ix at 1.6 angstrom resolution
PDB Compounds: (B:) Carbonic anhydrase 9

SCOPe Domain Sequences for d5dvxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dvxb_ b.74.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wryggdppwprvspacagrfqspvdirpqlaafspalrplelsgfqlpplpelrlrnngh
svqltlppglemklgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstkya
rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd
fsryfqyegslttppcaqgviwtvfnqtvslsakqlhtlsdtlwgpgdsrlqlnfratqp
lngrvieasfpagvd

SCOPe Domain Coordinates for d5dvxb_:

Click to download the PDB-style file with coordinates for d5dvxb_.
(The format of our PDB-style files is described here.)

Timeline for d5dvxb_: