Lineage for d5a8kc_ (5a8k C:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197885Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 2197886Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins)
    automatically mapped to Pfam PF02240
  6. 2197923Protein automated matches [320245] (2 species)
    not a true protein
  7. 2197929Species Methanothermobacter wolfeii [TaxId:145261] [320246] (2 PDB entries)
  8. 2197930Domain d5a8kc_: 5a8k C: [320391]
    Other proteins in same PDB: d5a8ka1, d5a8ka2, d5a8kb1, d5a8kb2, d5a8kd1, d5a8kd2, d5a8ke1, d5a8ke2
    automated match to d3m2vc_
    complexed with ca, com, etx, f43, k, mg, tp7

Details for d5a8kc_

PDB Entry: 5a8k (more details), 1.41 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter wolfeii at 1.4 a resolution
PDB Compounds: (C:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d5a8kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8kc_ d.58.31.1 (C:) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
aqyypgtskvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekvskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
gkvemvknqigdeldepvdlgepldeetlmdkttiyrvdgeayrddveaveimqrihvlr
sqggynpe

SCOPe Domain Coordinates for d5a8kc_:

Click to download the PDB-style file with coordinates for d5a8kc_.
(The format of our PDB-style files is described here.)

Timeline for d5a8kc_: