| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) ![]() each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
| Family d.58.31.1: Methyl-coenzyme M reductase gamma chain [55089] (2 proteins) automatically mapped to Pfam PF02240 |
| Protein automated matches [320245] (2 species) not a true protein |
| Species Methanothermobacter wolfeii [TaxId:145261] [320246] (2 PDB entries) |
| Domain d5a8kc_: 5a8k C: [320391] Other proteins in same PDB: d5a8ka1, d5a8ka2, d5a8kb1, d5a8kb2, d5a8kd1, d5a8kd2, d5a8ke1, d5a8ke2 automated match to d3m2vc_ complexed with ca, com, etx, f43, k, mg, tp7 |
PDB Entry: 5a8k (more details), 1.41 Å
SCOPe Domain Sequences for d5a8kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a8kc_ d.58.31.1 (C:) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
aqyypgtskvaqnrrnfcnpeyeleklreisdedvvkilghrapgeeypsvhppleemde
pedairemvepidgakagdrvryiqftdsmyfapaqpyvrsraylcryrgadagtlsgrq
iietrerdlekvskelleteffdparsgvrgksvhghslrldedgmmfdmlrrqiynkdt
gkvemvknqigdeldepvdlgepldeetlmdkttiyrvdgeayrddveaveimqrihvlr
sqggynpe
Timeline for d5a8kc_: