Lineage for d5a8ke2 (5a8k E:189-443)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719655Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2719656Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2719657Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 proteins)
    C-terminal domain is all-alpha
  6. 2719718Protein automated matches [315354] (4 species)
    not a true protein
  7. 2719733Species Methanothermobacter wolfeii [TaxId:145261] [320250] (1 PDB entry)
  8. 2719737Domain d5a8ke2: 5a8k E:189-443 [320385]
    Other proteins in same PDB: d5a8ka1, d5a8kb1, d5a8kc_, d5a8kd1, d5a8ke1, d5a8kf_
    automated match to d1hbnb1
    complexed with ca, com, etx, f43, k, mg, tp7

Details for d5a8ke2

PDB Entry: 5a8k (more details), 1.41 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter wolfeii at 1.4 a resolution
PDB Compounds: (E:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d5a8ke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8ke2 a.89.1.1 (E:189-443) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
gyalrnimvnhvvattlkntlqaaalstileqtamfemgdavgafermhllglayqgmna
dnlvfdlvkangkegtvgsviadlveraledgvikvekeltdykvygtddlamwnayaaa
glmaatmvnqgaaraaqgvsstllyyndliefetglpsvdfgkvegtavgfsffshsiyg
gggpgifngnhivtrhskgfaipcvaaamaldagtqmfspeatsglikevfsqvdefrep
lkyvveaaaeiknei

SCOPe Domain Coordinates for d5a8ke2:

Click to download the PDB-style file with coordinates for d5a8ke2.
(The format of our PDB-style files is described here.)

Timeline for d5a8ke2: