Lineage for d5cidc_ (5cid C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333085Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 2333086Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (205 PDB entries)
    Uniprot P00431
  8. 2333302Domain d5cidc_: 5cid C: [320373]
    Other proteins in same PDB: d5cidb_, d5cidd_
    automated match to d4p4qa_
    complexed with 51v, hem

Details for d5cidc_

PDB Entry: 5cid (more details), 2.76 Å

PDB Description: complex of yeast cytochrome c peroxidase (w191g) bound to o-toluidine with iso-1 cytochrome c
PDB Compounds: (C:) Cytochrome c peroxidase, mitochondrial

SCOPe Domain Sequences for d5cidc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5cidc_ a.93.1.1 (C:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkh
dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
gpkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkt
hlknsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliq
dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOPe Domain Coordinates for d5cidc_:

Click to download the PDB-style file with coordinates for d5cidc_.
(The format of our PDB-style files is described here.)

Timeline for d5cidc_: