![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
![]() | Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
![]() | Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
![]() | Protein automated matches [191055] (16 species) not a true protein |
![]() | Species Xanthomonas oryzae [TaxId:64187] [188927] (13 PDB entries) |
![]() | Domain d5cy7a_: 5cy7 A: [320370] automated match to d3dlda_ complexed with 56u, act, cd, na |
PDB Entry: 5cy7 (more details), 2.4 Å
SCOPe Domain Sequences for d5cy7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cy7a_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]} mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvlsydl
Timeline for d5cy7a_: