Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Dog (Canis familiaris) [TaxId:9615] [52610] (11 PDB entries) Uniprot P62825 |
Domain d1a2kc_: 1a2k C: [32037] Other proteins in same PDB: d1a2ka_, d1a2kb_ complexed with gdp, mg, so4 |
PDB Entry: 1a2k (more details), 2.5 Å
SCOPe Domain Sequences for d1a2kc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a2kc_ c.37.1.8 (C:) Ran {Dog (Canis familiaris) [TaxId: 9615]} qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev vmdpalaaqyehdlev
Timeline for d1a2kc_:
View in 3D Domains from other chains: (mouse over for more information) d1a2ka_, d1a2kb_, d1a2kd_, d1a2ke_ |