| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H4 [47125] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [192456] (59 PDB entries) |
| Domain d5b31b_: 5b31 B: [320356] Other proteins in same PDB: d5b31a_, d5b31c_, d5b31d_, d5b31e_, d5b31g_, d5b31h_ automated match to d1kx3f_ protein/DNA complex; complexed with cl, mn |
PDB Entry: 5b31 (more details), 2.2 Å
SCOPe Domain Sequences for d5b31b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b31b_ a.22.1.1 (B:) Histone H4 {Human (Homo sapiens) [TaxId: 9606]}
niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
dvvyalkrqgrtlygfgg
Timeline for d5b31b_: