Lineage for d5cxja_ (5cxj A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234288Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 2234289Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 2234455Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 2234456Protein automated matches [191055] (16 species)
    not a true protein
  7. 2234528Species Xanthomonas oryzae [TaxId:64187] [188927] (13 PDB entries)
  8. 2234536Domain d5cxja_: 5cxj A: [320353]
    automated match to d3dlda_
    complexed with 56t, act, cd, na

Details for d5cxja_

PDB Entry: 5cxj (more details), 2.38 Å

PDB Description: structure of xoo1075, a peptide deformylase from xanthomonas oryzae pv oryzae, in complex with fragment 124
PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5cxja_:

Sequence, based on SEQRES records: (download)

>d5cxja_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfeaserypeapavpltalanaqieplsdemengwegclsipglravipryryiryrgf
apdgspiereaegfharvvqheydhlvgrlypsrienfdtfgfddvlsyd

Sequence, based on observed residues (ATOM records): (download)

>d5cxja_ d.167.1.0 (A:) automated matches {Xanthomonas oryzae [TaxId: 64187]}
mirdiirmgdkrllrvapqvtnlgsaelhalvsdmfetmgaahgvglaapqiavdlqlmv
fgfpavpltalanaqieplsdemengwegclsipglravipryryiryrgfapdgspier
eaegfharvvqheydhlvgrlypsrienfdtfgfddvlsyd

SCOPe Domain Coordinates for d5cxja_:

Click to download the PDB-style file with coordinates for d5cxja_.
(The format of our PDB-style files is described here.)

Timeline for d5cxja_: