SCOPe 2.08: Domain d5b7ca2: 5b7c A:77-215

Lineage for d5b7ca2 (5b7c A:77-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Octopus vulgaris [TaxId:6645] [320351] (1 PDB entry)

8. Domain d5b7ca2: 5b7c A:77-215 [320352]
   Other proteins in same PDB: d5b7ca1
   automated match to d1pd211
   complexed with gsh, so4; mutant

Details for d5b7ca2

PDB Entry: 5b7c, 2.35 Å

PDB Description: crystal structure of octopus s-crystallin q108f mutant in complex with glutathione

PDB Compounds: (A:) S-crystallin OctvuS4

SCOPe Domain Sequences for d5b7ca2:

Sequence, based on SEQRES records:

>d5b7ca2 a.45.1.0 (A:77-215) automated matches {Octopus vulgaris [TaxId: 6645]}
gfhgrnnmemarvdfisdcfydilddymrmyfdgncrmmfqrsrdtssssekrmrfqetc
rrilpfmertlemysggsqyfmgdqmtmadmmcycalenplmeepsmlssypklmalrnr
vmnhskmssylqrrcrtef

Sequence, based on observed residues (ATOM records):

>d5b7ca2 a.45.1.0 (A:77-215) automated matches {Octopus vulgaris [TaxId: 6645]}
gfhgrnnmemarvdfisdcfydilddymrmyfdgncrmmfssekrmrfqetcrrilpfme
rtlemysggsqyfmgdqmtmadmmcycalenplmeepsmlssypklmalrnrvmnhskms
sylqrrcrtef

Timeline for d5b7ca2:

• d5b7ca2 first appeared in SCOPe 2.06
  
• d5b7ca2 appears in SCOPe 2.07