| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Octopus vulgaris [TaxId:6645] [320349] (1 PDB entry) |
| Domain d5b7ca1: 5b7c A:2-76 [320350] Other proteins in same PDB: d5b7ca2 automated match to d1pd212 complexed with gsh, so4; mutant |
PDB Entry: 5b7c (more details), 2.35 Å
SCOPe Domain Sequences for d5b7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b7ca1 c.47.1.0 (A:2-76) automated matches {Octopus vulgaris [TaxId: 6645]}
psytlhyfnhrgraeicrmlfaaagvqyndrriessewdsmrnkmpchmmpmleldnrtq
ipqsmamarylaref
Timeline for d5b7ca1: