Lineage for d1qg4a_ (1qg4 A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 393753Family c.37.1.8: G proteins [52592] (37 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 394046Protein Ran [52609] (2 species)
  7. 394047Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries)
  8. 394055Domain d1qg4a_: 1qg4 A: [32035]

Details for d1qg4a_

PDB Entry: 1qg4 (more details), 2.5 Å

PDB Description: canine gdp-ran f72y mutant

SCOP Domain Sequences for d1qg4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg4a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)}
epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd
tagqekygglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqtt

SCOP Domain Coordinates for d1qg4a_:

Click to download the PDB-style file with coordinates for d1qg4a_.
(The format of our PDB-style files is described here.)

Timeline for d1qg4a_: