Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) |
Family c.37.1.8: G proteins [52592] (23 proteins) |
Protein Ran [52609] (2 species) |
Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries) |
Domain d1qg4a_: 1qg4 A: [32035] |
PDB Entry: 1qg4 (more details), 2.5 Å
SCOP Domain Sequences for d1qg4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qg4a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)} epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd tagqekygglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp evvmdpalaaqyehdlevaqtt
Timeline for d1qg4a_: