Lineage for d1qg4a_ (1qg4 A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) 
Family c.37.1.8: G proteins [52592] (23 proteins) 
Protein Ran [52609] (2 species) 
Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries) 
Domain d1qg4a_: 1qg4 A: [32035]
Details for d1qg4a_
PDB Entry: 1qg4 (more details), 2.5 Å
PDB Description: canine gdp-ran f72y mutant
SCOP Domain Sequences for d1qg4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qg4a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)}
epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd
tagqekygglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqtt
SCOP Domain Coordinates for d1qg4a_:
Click to download the PDB-style file with coordinates for d1qg4a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qg4a_:
- d1qg4a_ first appeared (with stable ids) in SCOP 1.55
- d1qg4a_ appears in SCOP 1.57
- d1qg4a_ appears in SCOP 1.61
- d1qg4a_ appears in the current release, SCOPe 2.08
View in 3D
