SCOPe 2.08: Domain d1qg4a_: 1qg4 A:

Lineage for d1qg4a_ (1qg4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries)
   Uniprot P62825

8. Domain d1qg4a_: 1qg4 A: [32035]
   complexed with gdp, mg; mutant
   has additional insertions and/or extensions that are not grouped together

Details for d1qg4a_

PDB Entry: 1qg4, 2.5 Å

PDB Description: canine gdp-ran f72y mutant

PDB Compounds: (A:) protein (ran)

SCOPe Domain Sequences for d1qg4a_:

Sequence; same for both SEQRES and ATOM records:

>d1qg4a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
epqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwd
tagqekygglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqtt

Timeline for d1qg4a_:

• d1qg4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qg4a_ appears in SCOPe 2.07