![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189274] (54 PDB entries) |
![]() | Domain d5g42a1: 5g42 A:265-507 [320345] Other proteins in same PDB: d5g42a2, d5g42a3 automated match to d3l0la_ protein/DNA complex; complexed with 4tu, na |
PDB Entry: 5g42 (more details), 1.72 Å
SCOPe Domain Sequences for d5g42a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g42a1 a.123.1.0 (A:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]} aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke lfs
Timeline for d5g42a1: