| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Dendronephthya sp. [TaxId:51110] [320282] (1 PDB entry) |
| Domain d5exbj_: 5exb J: [320343] Other proteins in same PDB: d5exbb2, d5exbc2, d5exbd2, d5exbg2, d5exbk2, d5exbl2 automated match to d3svna_ complexed with gol |
PDB Entry: 5exb (more details), 1.81 Å
SCOPe Domain Sequences for d5exbj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5exbj_ d.22.1.0 (J:) automated matches {Dendronephthya sp. [TaxId: 51110]}
nlikedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttal
xnrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngm
nfppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvv
qlpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw
Timeline for d5exbj_: