Lineage for d1qg2a_ (1qg2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2124942Protein Ran [52609] (2 species)
  7. 2124943Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries)
    Uniprot P62825
  8. 2124951Domain d1qg2a_: 1qg2 A: [32034]
    complexed with gdp, mg; mutant

Details for d1qg2a_

PDB Entry: 1qg2 (more details), 2.5 Å

PDB Description: canine gdp-ran r76e mutant
PDB Compounds: (A:) protein (ran)

SCOPe Domain Sequences for d1qg2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qg2a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfggledgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqtta

SCOPe Domain Coordinates for d1qg2a_:

Click to download the PDB-style file with coordinates for d1qg2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qg2a_: