SCOP 1.71: Domain d1qg2a_: 1qg2 A:

Lineage for d1qg2a_ (1qg2 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (45 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Ran [52609] (2 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [52610] (6 PDB entries)

8. Domain d1qg2a_: 1qg2 A: [32034]
   complexed with gdp, mo4; mutant

Details for d1qg2a_

PDB Entry: 1qg2, 2.5 Å

PDB Description: canine gdp-ran r76e mutant

SCOP Domain Sequences for d1qg2a_:

Sequence; same for both SEQRES and ATOM records:

>d1qg2a_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)}
qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
gqekfggledgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
vmdpalaaqyehdlevaqtta

Timeline for d1qg2a_:

• d1qg2a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qg2a_ appears in SCOP 1.69
  
• d1qg2a_ appears in SCOP 1.73
  
• d1qg2a_ appears in the current release, SCOPe 2.08