Lineage for d1byub_ (1byu B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595107Protein Ran [52609] (2 species)
  7. 1595108Species Dog (Canis familiaris) [TaxId:9615] [52610] (10 PDB entries)
    Uniprot P62825
  8. 1595110Domain d1byub_: 1byu B: [32033]
    complexed with gdp, mg

Details for d1byub_

PDB Entry: 1byu (more details), 2.15 Å

PDB Description: canine gdp-ran
PDB Compounds: (B:) protein (GTP-binding protein ran)

SCOPe Domain Sequences for d1byub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byub_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikf
nvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
lappevvmdpalaaqyehdlevaqttalpdedddl

SCOPe Domain Coordinates for d1byub_:

Click to download the PDB-style file with coordinates for d1byub_.
(The format of our PDB-style files is described here.)

Timeline for d1byub_: