| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Ran [52609] (2 species) |
| Species Dog (Canis familiaris) [TaxId:9615] [52610] (9 PDB entries) Uniprot P62825 |
| Domain d1byub_: 1byu B: [32033] complexed with gdp, mg |
PDB Entry: 1byu (more details), 2.15 Å
SCOPe Domain Sequences for d1byub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byub_ c.37.1.8 (B:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikf
nvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
lappevvmdpalaaqyehdlevaqttalpdedddl
Timeline for d1byub_: