Lineage for d1byub_ (1byu B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23121Family c.37.1.8: G proteins [52592] (20 proteins)
  6. 23278Protein Ran [52609] (2 species)
  7. 23279Species Dog (Canis familiaris) [TaxId:9615] [52610] (5 PDB entries)
  8. 23281Domain d1byub_: 1byu B: [32033]

Details for d1byub_

PDB Entry: 1byu (more details), 2.15 Å

PDB Description: canine gdp-ran

SCOP Domain Sequences for d1byub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byub_ c.37.1.8 (B:) Ran {Dog (Canis familiaris)}
aaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikf
nvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcg
nkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampa
lappevvmdpalaaqyehdlevaqttalpdedddl

SCOP Domain Coordinates for d1byub_:

Click to download the PDB-style file with coordinates for d1byub_.
(The format of our PDB-style files is described here.)

Timeline for d1byub_: