SCOPe 2.07: Domain d5cxsa1: 5cxs A:14-287

Lineage for d5cxsa1 (5cxs A:14-287)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (45 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [188022] (46 PDB entries)

8. Domain d5cxsa1: 5cxs A:14-287 [320326]
   Other proteins in same PDB: d5cxsa2
   automated match to d1tcvb_
   complexed with mes

Details for d5cxsa1

PDB Entry: 5cxs, 1.75 Å

PDB Description: crystal structure of isoform 2 of purine nucleoside phosphorylase complexed with mes

PDB Compounds: (A:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d5cxsa1:

Sequence; same for both SEQRES and ATOM records:

>d5cxsa1 c.56.2.0 (A:14-287) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
maadyikrvsnvlpdigiicgsglgklieeieerkvipyinipnfpkttvaghvgnlvlg
svggrkivamqgrlhmyegysnqeialpirvmkllgvrvllitnlagginrklksgdfvl
ikghinfpglglnnvlvgpnqdefgprfpdlsnaydrllqqlalkiaqendfqdlvhegv
yafnggptyespdesnmllklgcdvvgmstvpeviiachcgikvlavsliannsildaen
dvsinhekvlavaekradllqmwfkeiitrlpld

Timeline for d5cxsa1:

• d5cxsa1 first appeared in SCOPe 2.06
  
• d5cxsa1 appears in the current release, SCOPe 2.08