Lineage for d5exbn_ (5exb N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2940748Species Dendronephthya sp. [TaxId:51110] [320282] (1 PDB entry)
  8. 2940762Domain d5exbn_: 5exb N: [320322]
    Other proteins in same PDB: d5exbb2, d5exbc2, d5exbd2, d5exbg2, d5exbk2, d5exbl2
    automated match to d3svna_
    complexed with gol

Details for d5exbn_

PDB Entry: 5exb (more details), 1.81 Å

PDB Description: wild type green fluorescent protein dendfp (dendronephthya sp.)
PDB Compounds: (N:) Green fluorescent protein

SCOPe Domain Sequences for d5exbn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5exbn_ d.22.1.0 (N:) automated matches {Dendronephthya sp. [TaxId: 51110]}
likedmrvkvhmegnvnghafviegegkgkpyegtqtlnltvkegaplpfsydilttalx
nrvftkypedipdyfkqsfpegyswertmtyedkgictirsdislegdcffqnvrfngmn
fppngpvmqkktlkwepsteklhvrdgllvgninmallleggghylcdfkttykakkvvq
lpdyhfvdhrieilsndsdynkvklyehgvarysplpsqaw

SCOPe Domain Coordinates for d5exbn_:

Click to download the PDB-style file with coordinates for d5exbn_.
(The format of our PDB-style files is described here.)

Timeline for d5exbn_: