Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Ran [52609] (2 species) |
Species Dog (Canis familiaris) [TaxId:9615] [52610] (20 PDB entries) Uniprot P62825 |
Domain d1byua_: 1byu A: [32032] complexed with gdp, mg |
PDB Entry: 1byu (more details), 2.15 Å
SCOPe Domain Sequences for d1byua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byua_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]} epqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwd tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp evvmdpalaaqyehdlevaqtt
Timeline for d1byua_: