Lineage for d1byua_ (1byu A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846662Protein Ran [52609] (2 species)
  7. 1846663Species Dog (Canis familiaris) [TaxId:9615] [52610] (11 PDB entries)
    Uniprot P62825
  8. 1846666Domain d1byua_: 1byu A: [32032]
    complexed with gdp, mg

Details for d1byua_

PDB Entry: 1byu (more details), 2.15 Å

PDB Description: canine gdp-ran
PDB Compounds: (A:) protein (GTP-binding protein ran)

SCOPe Domain Sequences for d1byua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byua_ c.37.1.8 (A:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
epqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwd
tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqtt

SCOPe Domain Coordinates for d1byua_:

Click to download the PDB-style file with coordinates for d1byua_.
(The format of our PDB-style files is described here.)

Timeline for d1byua_: