Lineage for d1byua_ (1byu A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582235Protein Ran [52609] (2 species)
  7. 582236Species Dog (Canis familiaris) [TaxId:9615] [52610] (6 PDB entries)
  8. 582237Domain d1byua_: 1byu A: [32032]

Details for d1byua_

PDB Entry: 1byu (more details), 2.15 Å

PDB Description: canine gdp-ran

SCOP Domain Sequences for d1byua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byua_ c.37.1.8 (A:) Ran {Dog (Canis familiaris)}
epqvqfklvlvgdggtgkttfvkrhltgefekkyvptlgvevhplvfhtnrgpikfnvwd
tagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvd
ikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalapp
evvmdpalaaqyehdlevaqtt

SCOP Domain Coordinates for d1byua_:

Click to download the PDB-style file with coordinates for d1byua_.
(The format of our PDB-style files is described here.)

Timeline for d1byua_: