Lineage for d5a8kd2 (5a8k D:270-549)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327973Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
    multihelical bundle; contains buried central helix
  4. 2327974Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families) (S)
  5. 2327975Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (3 protein domains)
    C-terminal domain is all-alpha
  6. 2328036Protein automated matches [315354] (2 species)
    not a true protein
  7. 2328046Species Methanothermobacter wolfeii [TaxId:145261] [320250] (1 PDB entry)
  8. 2328049Domain d5a8kd2: 5a8k D:270-549 [320319]
    Other proteins in same PDB: d5a8ka1, d5a8kb1, d5a8kc_, d5a8kd1, d5a8ke1, d5a8kf_
    automated match to d1hbna1
    complexed with ca, com, etx, f43, k, mg, tp7

Details for d5a8kd2

PDB Entry: 5a8k (more details), 1.41 Å

PDB Description: methyl-coenzyme m reductase from methanothermobacter wolfeii at 1.4 a resolution
PDB Compounds: (D:) methyl-coenzyme m reductase

SCOPe Domain Sequences for d5a8kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a8kd2 a.89.1.1 (D:270-549) automated matches {Methanothermobacter wolfeii [TaxId: 145261]}
rrargenepggvpfgyladicqssrvnyddpvrvsldvvatgamlydqiwlgsymsggvg
ftqyataaytdnilddftyfgkeyvedkyglceapntmdtvldiatevtfygleqyeeyp
alledqfggsqraavvaaaagcstafatgnaqtglsgwylsmylhkeqhsrlgfygydlq
dqcgasnvfsirgdeglplelrgpnypnyamnvghqgeyagisqaphaargdafvfnplv
kiafaddnlvfdftnvrgefakgalrefepageralitpa

SCOPe Domain Coordinates for d5a8kd2:

Click to download the PDB-style file with coordinates for d5a8kd2.
(The format of our PDB-style files is described here.)

Timeline for d5a8kd2: