Lineage for d5b31a_ (5b31 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698397Species Human (Homo sapiens) [TaxId:9606] [187038] (23 PDB entries)
  8. 2698411Domain d5b31a_: 5b31 A: [320316]
    Other proteins in same PDB: d5b31b_, d5b31c_, d5b31d_, d5b31f_, d5b31g_, d5b31h_
    automated match to d1eqzg_
    protein/DNA complex; complexed with cl, mn

Details for d5b31a_

PDB Entry: 5b31 (more details), 2.2 Å

PDB Description: the crystal structure of the heterotypic h2az/h2a nucleosome with h3.1.
PDB Compounds: (A:) Histone H3.1

SCOPe Domain Sequences for d5b31a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b31a_ a.22.1.1 (A:) Histone H3 {Human (Homo sapiens) [TaxId: 9606]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
aylvglfedtnlcaihakrvtimpkdiqlarrirger

SCOPe Domain Coordinates for d5b31a_:

Click to download the PDB-style file with coordinates for d5b31a_.
(The format of our PDB-style files is described here.)

Timeline for d5b31a_: