Lineage for d3rand_ (3ran D:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 581859Family c.37.1.8: G proteins [52592] (45 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 582235Protein Ran [52609] (2 species)
  7. 582236Species Dog (Canis familiaris) [TaxId:9615] [52610] (6 PDB entries)
  8. 582243Domain d3rand_: 3ran D: [32031]
    complexed with gdp, mg; mutant

Details for d3rand_

PDB Entry: 3ran (more details), 2.15 Å

PDB Description: canine gdp-ran q69l mutant

SCOP Domain Sequences for d3rand_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rand_ c.37.1.8 (D:) Ran {Dog (Canis familiaris)}
qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
ppevvmdpalaaqyehdlevaqt

SCOP Domain Coordinates for d3rand_:

Click to download the PDB-style file with coordinates for d3rand_.
(The format of our PDB-style files is described here.)

Timeline for d3rand_: