Lineage for d5czla_ (5czl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722036Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2722309Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2722310Protein automated matches [190108] (23 species)
    not a true protein
  7. 2722363Species Raoultella ornithinolytica [TaxId:54291] [320307] (1 PDB entry)
  8. 2722364Domain d5czla_: 5czl A: [320308]
    automated match to d1wzza1
    complexed with po4

Details for d5czla_

PDB Entry: 5czl (more details), 2.39 Å

PDB Description: crystal structure of a novel gh8 endo-beta-1,4-glucanase from an achatina fulica gut metagenomic library
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5czla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5czla_ a.102.1.0 (A:) automated matches {Raoultella ornithinolytica [TaxId: 54291]}
lprawadtawesyksrfmmadgrivdtgngsvshtegqgfamllavakndrpafdklwqw
tdktlrnkdnglfywrynpvapdpiadkndatdgdtliawallraqqqwgdksygiasda
itasllkstvitfaghqvmlpgakgfnrndhvnlnpsyfifpawqafaarthltawrklq
sdgkallgkmawgkaqlpsdwvalradgrmepakewpprmsydairiplylswadpqsal
ltpwkswfqsyprlqtpawvnvntndvapwfmtggllavrdlttgeaqddpqlsaqddyy
saslkmlvwlakndr

SCOPe Domain Coordinates for d5czla_:

Click to download the PDB-style file with coordinates for d5czla_.
(The format of our PDB-style files is described here.)

Timeline for d5czla_: