Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
Protein Mitochondrial cytochrome c [46642] (7 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [46643] (71 PDB entries) Uniprot P00044 |
Domain d5cidb_: 5cid B: [320304] Other proteins in same PDB: d5cida_, d5cidc_ automated match to d1ycca_ complexed with 51v, hem |
PDB Entry: 5cid (more details), 2.76 Å
SCOPe Domain Sequences for d5cidb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5cidb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} tefkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikk nvlwdennmseyltnpkkyipgtkmafgglkkekdrndlitylkkace
Timeline for d5cidb_: