Lineage for d3ranc_ (3ran C:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1163638Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1164288Protein Ran [52609] (2 species)
  7. 1164289Species Dog (Canis familiaris) [TaxId:9615] [52610] (8 PDB entries)
    Uniprot P62825
  8. 1164295Domain d3ranc_: 3ran C: [32030]
    complexed with gdp, mg; mutant

Details for d3ranc_

PDB Entry: 3ran (more details), 2.15 Å

PDB Description: canine gdp-ran q69l mutant
PDB Compounds: (C:) protein (GTP-binding nuclear protein ran)

SCOPe Domain Sequences for d3ranc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ranc_ c.37.1.8 (C:) Ran {Dog (Canis familiaris) [TaxId: 9615]}
qgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnv
wdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnk
vdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampala
ppevvmdpalaaqyehdlevaqt

SCOPe Domain Coordinates for d3ranc_:

Click to download the PDB-style file with coordinates for d3ranc_.
(The format of our PDB-style files is described here.)

Timeline for d3ranc_: